PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g108780.1
Common NameMTR_1g108780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 462aa    MW: 53606.9 Da    PI: 8.9248
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g108780.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.66e-1512881799
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     ++p+ f+e++ g+   sk + l++++ ++We+ l  +kk+g +++++GWkeF+    L+ g +v+F+++++s f   v +f+k
  Medtr1g108780.1 12 RIPNAFTEKYIGD--LSKPMFLKTPDVKEWEIHL--TKKDGDIWIQRGWKEFATHYSLDHGHMVLFQYQKTSHF--EVYIFDK 88
                     79********666..6667***************..********************************998999..9999997 PP

2B3452e-14204290398
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                       ++t s+v++   + +p +f +++ +++++  ++ l+   + r+W vk++   ++    +++GWk Fv++n+Lk gD+++F+++++++  ++v 
  Medtr1g108780.1 204 AIMTYSYVNQ--YMHVPLNFEQKYLKEQQS--EIALQVlDDERTWIVKYC--LRK----MSNGWKTFVSDNNLKLGDVCLFEMINSKSYAFKVL 287
                      3444444444..3899****9999544334..6666663367*******4..444....569********************999888889999 PP

                      EE- CS
               B3  96 vfr 98 
                      +fr
  Medtr1g108780.1 288 IFR 290
                      998 PP

3B343.36.5e-143824591999
                      -HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3  19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                       ++f +++ g+k++     + + + + W v+l y  +  ++ l++GW+ Fv++n+L++gD++vF l ++++  l v++fr 
  Medtr1g108780.1 382 RNSFSSKYLGPKKK---TAMLQFEEKLWPVQLMYYPSEPATKLGEGWSLFVEENKLQAGDVCVFVLANKEDVVLDVHIFRG 459
                      57788888666433...55667788*******99999999*************************9988999999999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.887189IPR003340B3 DNA binding domain
SMARTSM010192.7E-4689IPR003340B3 DNA binding domain
SuperFamilySSF1019364.51E-161189IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-171189IPR015300DNA-binding pseudobarrel domain
PfamPF023626.8E-131288IPR003340B3 DNA binding domain
CDDcd100173.11E-121287No hitNo description
Gene3DG3DSA:2.40.330.103.3E-21194291IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-21195292IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.576200292IPR003340B3 DNA binding domain
CDDcd100172.19E-17200290No hitNo description
PfamPF023623.9E-12202290IPR003340B3 DNA binding domain
SMARTSM010194.9E-13202292IPR003340B3 DNA binding domain
SuperFamilySSF1019366.47E-15360458IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.7E-17360458IPR015300DNA-binding pseudobarrel domain
CDDcd100175.03E-13363458No hitNo description
SMARTSM010191.7E-10364460IPR003340B3 DNA binding domain
PfamPF023628.2E-12381459IPR003340B3 DNA binding domain
PROSITE profilePS5086311.35406460IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MHANINFNVL QRIPNAFTEK YIGDLSKPMF LKTPDVKEWE IHLTKKDGDI WIQRGWKEFA  60
THYSLDHGHM VLFQYQKTSH FEVYIFDKST FEIEYRVDGN NQHEQSNPIE ILDEQPSYKK  120
SRPKSQISSS QPLKKLRIDA SEDVGTSSKS QNIPKLVQVK EEIDSTTKCL NVKHGQEQRN  180
STAKIVEALN KAKNYESNNP FFTAIMTYSY VNQYMHVPLN FEQKYLKEQQ SEIALQVLDD  240
ERTWIVKYCL RKMSNGWKTF VSDNNLKLGD VCLFEMINSK SYAFKVLIFR VDEEQHSLPP  300
QVHGDGVNWL ETAGITEVKS KTIMSYKGTK ETQRNSLQAR PCSFKNSEAK KEANQFTSTL  360
EKPNFTINLR SSHWDVYRPR VRNSFSSKYL GPKKKTAMLQ FEEKLWPVQL MYYPSEPATK  420
LGEGWSLFVE ENKLQAGDVC VFVLANKEDV VLDVHIFRGR S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1717829324144B3 domain-containing transcription factor VRN
4i1k_B4e-1717829324144B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003592583.20.0transcriptional factor B3 family protein
TrEMBLG7IAW30.0G7IAW3_MEDTR; Transcriptional factor B3 family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.17e-40B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]